Sentencedict.com
 Directly to word page Vague search(google)
Home > Ming dynasty in a sentence

Ming dynasty in a sentence

  up(0)  down(0)
Sentence count:118Posted:2017-08-24Updated:2020-07-24
Similar words: qing dynastysong dynastytang dynastyshang dynastydynastynastyunassumingdynamoMeaning: n. the imperial dynasty of China from 1368 to 1644. 
Random good picture Not show
(1) Ming dynasty based its legalization on ethics.
(2) Sweet-scented osmanthus cake created in the late Ming Dynasty.
(3) China had the suzerainty over Ryukyu since Ming Dynasty.
(4) Nicknames: Little Giant, The Ming Dynasty , The Great Wall, etc.
(5) The Ming dynasty, finding series, was ordered to chase nine agent provocateur order "ghost king seven steal".
(6) Zhu Zaiyu, an outstanding expert of Ming Dynasty, first created the theory of twelve_tone equal temperament in the world.
(7) I want to make the Ming Dynasty, which compared with full-dress ?
(8) In 1371, the Ming Dynasty Hongwu four years, Chagatai Khanate perish, for many separatism in Xinjiang separatist regimes.
(9) The Yuan and Ming Dynasty is a declining period in the course of the Epigraphy development.
(10) During the early Ming Dynasty, the system of a monthly official price assessment was implemented. When a purchase of material was done, it would be used as a basis for price.
(11) Song and Ming Dynasty is a very important period for philosophy and theorization of Chinese Medicine.
(12) Zhu Zaiyu, an outstanding scientist and artist of Ming Dynasty, was the first person in the world to found the theory of twelve-tone equal temperament.
(13) Therefore, based on the Law of Ming Dynasty and complemented with various legal forms, a closely knit law network was established for the severe punishment of heresies.
(14) Sprouting in the middle-and-late Ming dynasty, the pawnbroking reached its peak in the Kangqian era, based on the capital accumulation and the support of the Qing government.
(15) In the Ming dynasty(Sentencedict.com), the local governments became a hotbed of corruption.
(16) Bias is the of basic tendency Ming Dynasty politics domain morals life.
(17) There is no doubt that the Qing Dynasty postdates the Ming Dynasty.
(18) The Mu family acted as the part of depute to Ming Dynasty from beginning to end, played the role of a bridge and link in the relationship between Ming Dynasty and Thailand and Laos.
(19) The Famen Temple, Chia Kuei is a trusted lackey of Liu Chin , a Ming Dynasty eunuch.
(20) The diplomatic protocol of the reception of envoys of the Ming Dynasty and Tamerlane Empire were similar in procedure and usually the custom of the visiting envoys were respected by each side.
(21) Hang Tuah and friends were all from China, they were being assigned to the Malacca Sultanate because Parameswara requested the Ming Dynasty Emperor for protection!
(22) Ye is the 49th family name in China and an old large family name in Huizhou recorded in A History of Illustrious Families in Xin'an in the Ming Dynasty.
(23) With the rapid formation of Shanxi merchants in the Ming dynasty, there was an acceleration of the shipments both in the local area and in the whole country.
(24) In the reconstruction process of social order at the beginning stage of Qing Dynasty, the descendants of the Ming Dynasty are political dissident force of consequence.
(25) One of important factors contributing to the powerful and long-drawn-out movement in literary revivalism by the revivalists in Ming Dynasty is that they took a firm stand in literary ontology.
(26) The debates about ancientness and modernness between Minturno and Cinthio in the Italian Renaissance and seven men of letters in the Ming Dynasty of China are the two typical ones.
(27) Noting historical instances of societal collapse—the Mameluke Sultanate in Egypt,[sentencedict.com] the Ming Dynasty in China—he cautions that America might face a similar fate.
(28) China boasts the world's earliest observatory, built in Nanking in 1385 in the Ming Dynasty ( 1368 A . D . - 1644 A . D . ), three.
(29) The Yu Garden is characteristic of the architectural style of the Ming dynasty.
(30) Li RiHua is a writer, reviewer and appreciator of late Ming dynasty.
More similar words: qing dynastysong dynastytang dynastyshang dynastydynastynastyunassumingdynamodynamicdynamismdynamitedynamicsmyringoplastydynamicallyaerodynamicthermodynamichydrodynamicaerodynamicsthermodynamicsfirst law of thermodynamicssecond law of thermodynamicshastyin a stewnastilygymnasttastypastyvastymonasticnastiness
Total 118, 30 Per page  1/4  «first  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words